PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 568aa    MW: 62340.8 Da    PI: 4.8942
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006727.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.7e-39188247261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k++
  Do006727.1 188 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKNA 247
                 7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31174245IPR003851Zinc finger, Dof-type
PfamPF027014.4E-32190246IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.891192246IPR003851Zinc finger, Dof-type
PROSITE patternPS013610194230IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MLDQKDPGIK LFGRVIPLAP EPAPGITMET EEPPGHDQPP EEAAAAVADE DQHNEKEEKE  60
DCEMKVDTPQ EKGNEMKVDT PQENGNELKI DMPQEEKGNE MKFDAPQTEQ DGEMKVNAQQ  120
EKKDEPMKVD ALPITENTQQ RSLPTLDHKK EDQGQMNSTE DKAVSDPKRE NEKTSNDESG  180
QDKTLKKPDK ILPCPRCNSM DTKFCYYNNY NVNQPRHFCK NCQRYWTAGG TMRNVPVGAG  240
RRKSKNASLH YRQLLMAPDC MLGSRVDMSK SVLPEALLSP HSAPLQPTSR NETVLKFGPE  300
VPLCESMVSA LNIDEQNLKN PGSAPSGENR EDNSCASSVT SYNGLPENTV QVDKNGAPIY  360
CNGVAPVPQY YLGTPFLYPW SVGWNNLPMM VPGKNMPESA SASESCSNSS APWMTSPMMP  420
ASRLPGPAFP YPLVPPALWG CLSGWPATTW NIPWVRTNGC VSPSSSSNSS CSGNGSPTLG  480
KHSRDCNPLK DEKIEKSLWV PKTLRIDDPD EAAKSSIWAT LGIKPGDPGT FKPFQSKVES  540
KGQKSDAAQV LQANPAALSR SQSFQESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2995600.0KF299560.1 Miscanthus sacchariflorus clone Msac_GC_7 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967771.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLK3XFM00.0K3XFM0_SETIT; Uncharacterized protein
STRINGSi000689m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-69cycling DOF factor 2